PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00086.1_g00013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 290aa    MW: 33014.4 Da    PI: 6.7515
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00086.1_g00013.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.71.7e-072412732254
                              SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                 Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                               +yp+++++++L +++gL+ +q+ +WF N+R +
  Rsa1.0_00086.1_g00013.1 241 WPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 273
                              58*****************************87 PP

2ELK22.72.2e-08194215122
                      ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                              ELK +L++++++++ ++++E++
  Rsa1.0_00086.1_g00013.1 194 ELKLELKQGFKSRIEDVREEIM 215
                              9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012556.6E-192872IPR005540KNOX1
PfamPF037901.7E-163070IPR005540KNOX1
SMARTSM012563.6E-2582137IPR005541KNOX2
PfamPF037913.4E-1986136IPR005541KNOX2
PROSITE profilePS512139.202194214IPR005539ELK domain
PROSITE profilePS5007111.823214277IPR001356Homeobox domain
SMARTSM003899.6E-11216281IPR001356Homeobox domain
SuperFamilySSF466892.35E-16216279IPR009057Homeodomain-like
CDDcd000869.59E-12217278No hitNo description
Gene3DG3DSA:1.10.10.605.4E-25221277IPR009057Homeodomain-like
PfamPF059203.2E-18234273IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010089Biological Processxylem development
GO:0010192Biological Processmucilage biosynthetic process
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MQETALGMIG ATVGGGDREA VLVVEQNRQM KGEIATHPMY EQLLAAHVAC LRVATPIDQL  60
PIIEAQLSRS QHLLRSYAST AVGFSHHDRH ELDNFLAQYV MVLCSFKEQL QQHVRVHAVE  120
AVMACREIEN NLHSLTGAIL GEGSGATMSE DEDDFQMDFS LDTSDLSCGH DMTGFGPLLP  180
TESERSLMER VRQELKLELK QGFKSRIEDV REEIMRKRRA GKLPGDTTTV LKNWWQQHCK  240
WPYPTEDDKA KLVEETGLQL KQINNWFINQ RKRNWHNSHS LASSKSKRKH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A3e-13217273864Homeobox protein PKNOX1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankZ290730.0Z29073.1 B.napus hd1 mRNA for homeodomain-containing protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010430375.10.0PREDICTED: homeobox protein knotted-1-like 7
SwissprotQ9FPQ80.0KNAT7_ARATH; Homeobox protein knotted-1-like 7
TrEMBLA0A0D3E3T30.0A0A0D3E3T3_BRAOL; Uncharacterized protein
STRINGBra027006.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44428158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.10.0KNOTTED-like homeobox of Arabidopsis thaliana 7